Structure of PDB 6hom Chain A Binding Site BS01

Receptor Information
>6hom Chain A (length=273) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHMLEREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGT
IAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLA
AHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTE
IIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAMI
LGKMVLQLSKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTF
AQVLKDDTTTKRWLAQLVKNLQE
Ligand information
>6hom Chain B (length=25) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDLGFDPFVETQKGLAELMENEVVQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hom A conserved CAF40-binding motif in metazoan NOT4 mediates association with the CCR4-NOT complex.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R46 A84 H85 N88 C91 N92 A95 R130 Y134 L137 T138 K148 L177 T180 V181 F184 K188
Binding residue
(residue number reindexed from 1)		R34 A72 H73 N76 C79 N80 A83 R118 Y122 L125 T126 K136 L165 T168 V169 F172 K176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006402 mRNA catabolic process
Cellular Component
GO:0030014 CCR4-NOT complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hom, PDBe:6hom, PDBj:6hom
PDBsum6hom
PubMed30692204
UniProtQ92600|CNOT9_HUMAN CCR4-NOT transcription complex subunit 9 (Gene Name=CNOT9)

[Back to BioLiP]