Structure of PDB 6hm4 Chain A Binding Site BS01

Receptor Information
>6hm4 Chain A (length=182) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPLKGFVICCTSIDLKQRTEISTKATKLGAAYRSDFTKDVTHLIAGDFDT
PKYKFAAKSRPDIKIMSSEWIPVLYESWVQGEDLDDGLLVDKHFLPTLFK
CRVCLTNIGQPERSRIENYVLKHGGTFCPDLTRDVTHLIAGTSSGRKYEY
ALKWKINVVCVEWLWQSIQRNAVLEPQYFQLD
Ligand information
>6hm4 Chain B (length=9) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVMTVPNTP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hm4 BRCT domains of the DNA damage checkpoint proteins TOPBP1/Rad4 display distinct specificities for phosphopeptide ligands.
Resolution1.77019 Å
Binding residue
(original residue number in PDB)		T110 R117 P133 D134 L135 R137 R150 K151 Y154
Binding residue
(residue number reindexed from 1)		T106 R113 P129 D130 L131 R133 R146 K147 Y150
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6hm4, PDBe:6hm4, PDBj:6hm4
PDBsum6hm4
PubMed30295604
UniProtP32372|RAD4_SCHPO S-M checkpoint control protein rad4 (Gene Name=rad4)

[Back to BioLiP]