Structure of PDB 6hl1 Chain A Binding Site BS01

Receptor Information
>6hl1 Chain A (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMA
TNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKSDL
LEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQY
IKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHH
AEMLMSWRVNDHKFTPLLCEIWDVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hl1 Molecular tuning of farnesoid X receptor partial agonism.
Resolution1.599 Å
Binding residue
(original residue number in PDB)		V299 K303 H313 E314 Q316 I317 K321 P463 L464 E467
Binding residue
(residue number reindexed from 1)		V58 K62 H72 E73 Q75 I76 K80 P216 L217 E220
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
GO:0032052 bile acid binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0038183 bile acid signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6hl1, PDBe:6hl1, PDBj:6hl1
PDBsum6hl1
PubMed31266946
UniProtQ96RI1|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]