Structure of PDB 6h9o Chain A Binding Site BS01

Receptor Information
>6h9o Chain A (length=196) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKLVLTGERHYTRNDDIRQSILALGQDVNIIQTQIEQRLPWIKQVSVRKQ
WPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPE
GSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRG
DTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLP
Ligand information
>6h9o Chain B (length=24) Species: 585035 (Escherichia coli S88) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEALEERARNELSKTRPGETFYRL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h9o Structural Analysis of the Interaction between the Bacterial Cell Division Proteins FtsQ and FtsB.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R196 S198 R213 R222 E225 L226 L230 Y243 D245 R247 Y248 S250 G251 A252 A253 V254 W256
Binding residue
(residue number reindexed from 1)		R132 S134 R149 R158 E161 L162 L166 Y179 D181 R183 Y184 S186 G187 A188 A189 V190 W192
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0090529 cell septum assembly

View graph for
Biological Process
External links
PDB RCSB:6h9o, PDBe:6h9o, PDBj:6h9o
PDBsum6h9o
PubMed30206170
UniProtP06136|FTSQ_ECOLI Cell division protein FtsQ (Gene Name=ftsQ)

[Back to BioLiP]