Structure of PDB 6h8c Chain A Binding Site BS01

Receptor Information
>6h8c Chain A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYL
VPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKD
EDGFLYVAYSGENTFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h8c An atypical LIR motif within UBA5 (ubiquitin like modifier activating enzyme 5) interacts with GABARAP proteins and mediates membrane localization of UBA5.
ResolutionN/A
Binding residue
(original residue number in PDB)		M4 F5 E12 E17 Y25 R28 K46 R47 K48 Y49 L50 V51 P52 Q59 I63 K66
Binding residue
(residue number reindexed from 1)		M4 F5 E12 E17 Y25 R28 K46 R47 K48 Y49 L50 V51 P52 Q59 I63 K66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000149 SNARE binding
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
GO:0048487 beta-tubulin binding
GO:0050811 GABA receptor binding
GO:0051117 ATPase binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006891 intra-Golgi vesicle-mediated transport
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0015031 protein transport
GO:0032781 positive regulation of ATP-dependent activity
GO:0070972 protein localization to endoplasmic reticulum
GO:0097352 autophagosome maturation
GO:1901799 negative regulation of proteasomal protein catabolic process
Cellular Component
GO:0000139 Golgi membrane
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005776 autophagosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h8c, PDBe:6h8c, PDBj:6h8c
PDBsum6h8c
PubMed30990354
UniProtP60520|GBRL2_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 2 (Gene Name=GABARAPL2)

[Back to BioLiP]