Structure of PDB 6h7b Chain A Binding Site BS01

Receptor Information
>6h7b Chain A (length=78) Species: 5664 (Leishmania major) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPPITPQELESMSPQEQRAALGDRLFLKVYEIAPELAPKITGMFLEMKPK
EAYELLNDQKRLEERVTEALCVLKAHQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h7b The Leishmania PABP1-eIF4E4 interface: a novel 5'-3' interaction architecture for trans-spliced mRNAs.
Resolution1.89 Å
Binding residue
(original residue number in PDB)		G503 D504 F507 P519 K520 T522 M524 L526 E527 E549 A550 V553 H557
Binding residue
(residue number reindexed from 1)		G22 D23 F26 P38 K39 T41 M43 L45 E46 E68 A69 V72 H76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6h7b, PDBe:6h7b, PDBj:6h7b
PDBsum6h7b
PubMed30476241
UniProtE9AFX7

[Back to BioLiP]