Structure of PDB 6h3r Chain A Binding Site BS01

Receptor Information
>6h3r Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSPVVKRLLGWKKSNGQEEKWSEKAVKSLVKKLKKTGRLDELEKAITTQN
MNTKCVTIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENC
EYAFNLKKDEVCVNPYHYQRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h3r Structural basis for distinct roles of SMAD2 and SMAD3 in FOXH1 pioneer-directed TGF-beta signaling
Resolution2.75 Å
Binding residue
(original residue number in PDB)		S80 L81 L85 Q86 S88 K91
Binding residue
(residue number reindexed from 1)		S61 L62 L66 Q67 S69 K72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h3r, PDBe:6h3r, PDBj:6h3r
PDBsum6h3r
PubMed
UniProtB7Z5N5

[Back to BioLiP]