Structure of PDB 6h22 Chain A Binding Site BS01

Receptor Information
>6h22 Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLY
DAAQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h22 Water-soluble, stable and azide-reactive strained dialkynes for biocompatible double strain-promoted click chemistry.
Resolution2.006 Å
Binding residue
(original residue number in PDB)		Q24 K51 L54 G58 I61 M62 Y67 Q72 H73 V93 H96
Binding residue
(residue number reindexed from 1)		Q7 K34 L37 G41 I44 M45 Y50 Q55 H56 V76 H79
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h22, PDBe:6h22, PDBj:6h22
PDBsum6h22
PubMed31418442
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]