Structure of PDB 6h1e Chain A Binding Site BS01

Receptor Information
>6h1e Chain A (length=207) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGS
GVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVK
GLLPRLTEKVDLLVFNPPYVVTPPQEVGSHGIEAAWAGGRNGREVMDRFF
PLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETL
SVLKFTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6h1e KMT9 monomethylates histone H4 lysine 12 and controls proliferation of prostate cancer cells.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y23 E24 D28 N122 P123 Y125 A141 W142 E204
Binding residue
(residue number reindexed from 1)		Y17 E18 D22 N116 P117 Y119 A135 W136 E198
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008276 protein methyltransferase activity
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity
GO:0030791 arsenite methyltransferase activity
GO:0036009 protein-glutamine N-methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0140984 histone H4K12 methyltransferase activity
GO:1904047 S-adenosyl-L-methionine binding
Biological Process
GO:0006325 chromatin organization
GO:0009404 toxin metabolic process
GO:0018364 peptidyl-glutamine methylation
GO:0018872 arsonoacetate metabolic process
GO:0030307 positive regulation of cell growth
GO:0032259 methylation
GO:0045814 negative regulation of gene expression, epigenetic
GO:0045815 transcription initiation-coupled chromatin remodeling
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol
GO:0032991 protein-containing complex
GO:0035657 eRF1 methyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h1e, PDBe:6h1e, PDBj:6h1e
PDBsum6h1e
PubMed31061526
UniProtQ9Y5N5|N6MT1_HUMAN Methyltransferase N6AMT1 (Gene Name=N6AMT1)

[Back to BioLiP]