Structure of PDB 6gx6 Chain A Binding Site BS01

Receptor Information

>6gx6 Chain A (length=159) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSMNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDES
WALKAIEALSGKIELHGKPIEVEHSVPKRQRIRKLQIRNIPPHLQWEVLD
SLLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFT
LKVAYIPDE

Ligand information

>6gx6 Chain B (length=4) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acac

....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6gx6 Structural basis of IMP3 RRM12 recognition of RNA.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	Y5 K36 Y39 F41 S73 V74 R79
Binding residue (residue number reindexed from 1)	Y7 K38 Y41 F43 S75 V76 R81
Binding affinity	PDBbind-CN: Kd=4.7uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:6gx6, PDBe:6gx6, PDBj:6gx6
PDBsum	6gx6
PubMed	30135093
UniProt	O00425\|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 (Gene Name=IGF2BP3)

[Back to BioLiP]