Structure of PDB 6gvl Chain A Binding Site BS01

Receptor Information
>6gvl Chain A (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPDTPTRLVFSALGPTSLRVSWQEPRCPLQGYSVEYQLLNGGELHRLNIP
NPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQLPGSAFT
LSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEMAQGGGPA
TAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIES
Ligand information
>6gvl Chain B (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SNENLLLVHCGPTLINSCISFGS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gvl Integrin alpha 6 beta 4 Recognition of a Linear Motif of Bullous Pemphigoid Antigen BP230 Controls Its Recruitment to Hemidesmosomes.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		R1463 L1464 V1465 F1466 S1467 R1542 G1544 P1562 G1563 L1568 L1577 V1578 F1579 T1580 A1581 P1656 E1657 R1658 E1659 I1661 I1662 T1663 I1664 E1665
Binding residue
(residue number reindexed from 1)		R7 L8 V9 F10 S11 R84 G86 P95 G96 L101 L110 V111 F112 T113 A114 P189 E190 R191 E192 I194 I195 T196 I197 E198
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6gvl, PDBe:6gvl, PDBj:6gvl
PDBsum6gvl
PubMed31006587
UniProtP16144|ITB4_HUMAN Integrin beta-4 (Gene Name=ITGB4)

[Back to BioLiP]