Structure of PDB 6gtz Chain A Binding Site BS01

Receptor Information
>6gtz Chain A (length=279) Species: 488477 (Escherichia coli F18+) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPE
TITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTD
KPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYA
NNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGT
TADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSL
GLTANYARTGGQVTAGNVQSIIGVTFVYQ
Ligand information
>6gtz Chain B (length=13) Species: 362663 (Escherichia coli 536) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADVTITVNGKVVA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gtz Binding of the Bacterial Adhesin FimH to Its Natural, Multivalent High-Mannose Type Glycan Targets.
Resolution1.719 Å
Binding residue
(original residue number in PDB)		A115 A165 R166 D167 V168 T169 V170 T171 L172 D174 Y175 Y256 A265 G266 V268 Q269 S270 I271 I272 G273 V274 T275 F276
Binding residue
(residue number reindexed from 1)		A115 A165 R166 D167 V168 T169 V170 T171 L172 D174 Y175 Y256 A265 G266 V268 Q269 S270 I271 I272 G273 V274 T275 F276
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
Biological Process
GO:0007155 cell adhesion
GO:0043709 cell adhesion involved in single-species biofilm formation
Cellular Component
GO:0009289 pilus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gtz, PDBe:6gtz, PDBj:6gtz
PDBsum6gtz
PubMed30543411
UniProtA0A0R4I961

[Back to BioLiP]