Structure of PDB 6gqn Chain A Binding Site BS01

Receptor Information
>6gqn Chain A (length=62) Species: 171101 (Streptococcus pneumoniae R6) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAALVKSLRQ
EIADLKEELTRK
Ligand information
>6gqn Chain G (length=13) Species: 1313 (Streptococcus pneumoniae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ILRRSRSDRKKLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gqn The cell cycle regulator GpsB functions as cytosolic adaptor for multiple cell wall enzymes.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K9 F12 E13 Q14 E15 D29 D33
Binding residue
(residue number reindexed from 1)		K8 F11 E12 Q13 E14 D28 D32
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6gqn, PDBe:6gqn, PDBj:6gqn
PDBsum6gqn
PubMed30651563
UniProtQ8DR57|GPSB_STRR6 Cell cycle protein GpsB (Gene Name=gpsB)

[Back to BioLiP]