Structure of PDB 6gov Chain A Binding Site BS01

Receptor Information
>6gov Chain A (length=420) Species: 83334 (Escherichia coli O157:H7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNKEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQID
RKSGDFDTFRRWLVVDEVTQPTKEITLEAARYEDESLNLGDYVEDQIESV
TFDRITTQTAKQVIVQKVREAERAMVVDQFREHEGEIITGVVKKVNRDNI
SLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPEARGAQLFVTRS
KPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGA
CVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDE
DKHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMTVDDLQAKHQA
EAHAAIDAFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIEGLDE
PTVEALRERAKNALATIAQA
Ligand information
>6gov Chain R (length=48) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuuuaacauuaagcccugaagaagggcaaaaauaaaccagcguguggc
............<<<<<.....>>>>>.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gov Structural Basis for the Action of an All-Purpose Transcription Anti-termination Factor.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		N172 G231 S232 D246 V248 G249 A250 V252 G253 M254 R255 G256 Q260 G268 R270 I271 D272 A289 I318 R320 N321 G322 V338
Binding residue
(residue number reindexed from 1)		N172 G231 S232 D246 V248 G249 A250 V252 G253 M254 R255 G256 Q260 G268 R270 I271 D272 A289 I318 R320 N321 G322 V338
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0003676 nucleic acid binding
GO:0003700 DNA-binding transcription factor activity
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019904 protein domain specific binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0031554 regulation of termination of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
GO:0051259 protein complex oligomerization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gov, PDBe:6gov, PDBj:6gov
PDBsum6gov
PubMed30795892
UniProtP0AFF6|NUSA_ECOLI Transcription termination/antitermination protein NusA (Gene Name=nusA)

[Back to BioLiP]