Structure of PDB 6ghl Chain A Binding Site BS01

Receptor Information

>6ghl Chain A (length=338) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKY
DSMLGIFQDAEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEA
TGVFTSREGASKHLSAGAKKVLITAPGKGNIPTYVVGVNHHTYDPSEDIV
SNASCTTNCLAPIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRR
ARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPNVSVVDFVAQ
VEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDAS
LTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA

Ligand information

>6ghl Chain E (length=21) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TSFQQYCDDNPDAAECRIYDD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6ghl Structural basis of light-induced redox regulation in the Calvin-Benson cycle in cyanobacteria.
Resolution	2.378 Å
Binding residue (original residue number in PDB)	T37 S38 D39 S79 R81
Binding residue (residue number reindexed from 1)	T38 S39 D40 S80 R82

Enzymatic activity

Enzyme Commision number

1.2.1.-

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491	oxidoreductase activity
GO:0016620	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0046872	metal ion binding
GO:0050661	NADP binding
GO:0051287	NAD binding

	Biological Process
GO:0006006	glucose metabolic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6ghl, PDBe:6ghl, PDBj:6ghl
PDBsum	6ghl
PubMed	31570616
UniProt	Q8DIW5

[Back to BioLiP]