Structure of PDB 6gat Chain A Binding Site BS01

Receptor Information

>6gat Chain A (length=66) Species: 162425 (Aspergillus nidulans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKNGEQNGPTTCTNCFTQTTPVWRRNPEGQPLCNACGLFLKLHGVVRPLS
LKTDVIKKRNRNSANS

Ligand information

>6gat Chain B (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cagtgatagagac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6gat The solution structure of the Leu22-->Val mutant AREA DNA binding domain complexed with a TGATAG core element defines a role for hydrophobic packing in the determination of specificity.
Resolution	N/A
Binding residue (original residue number in PDB)	R24 R59
Binding residue (residue number reindexed from 1)	R24 R59
Binding affinity	PDBbind-CN: Kd=20uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6gat, PDBe:6gat, PDBj:6gat
PDBsum	6gat
PubMed	9533884
UniProt	P17429\|AREA_EMENI Nitrogen regulatory protein areA (Gene Name=areA)

[Back to BioLiP]