Structure of PDB 6g55 Chain A Binding Site BS01

Receptor Information
>6g55 Chain A (length=81) Species: 55518 (Magnetospirillum gryphiswaldense) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMEAVQNRIVEAAERVPGVRGVIHLRARYVGQDIWADMIIGVDPENTVE
QAHEISEAVQAAVCGKIRRIESLHVSAEARE
Ligand information
>6g55 Chain D (length=7) Species: 55518 (Magnetospirillum gryphiswaldense) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SFDEVML
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6g55 Metal binding to the dynamic cytoplasmic domain of the cation diffusion facilitator (CDF) protein MamM induces a 'locked-in' configuration.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		R238 R240 W247 A248 S283
Binding residue
(residue number reindexed from 1)		R27 R29 W36 A37 S72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6g55, PDBe:6g55, PDBj:6g55
PDBsum6g55
PubMed30811856
UniProtV6F235|MAMM_MAGGM Magnetosome protein MamM (Gene Name=mamM)

[Back to BioLiP]