Structure of PDB 6g1t Chain A Binding Site BS01

Receptor Information
>6g1t Chain A (length=115) Species: 1351 (Enterococcus faecalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKINLNQIYTAKEMSERIGKNRNYLSQAYRNNKHEILKNFNYRKIGGTII
FSDNPNNDLSQLITAKEASQLLGKNDEYFAHIYKRFPHRLEGIDHIYTGK
TLFLTKESLEVFKKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6g1t TraN: A novel repressor of an Enterococcus conjugative type IV secretion system.
Resolution1.93 Å
Binding residue
(original residue number in PDB)		K21 N22 R23 Y25 Q28 G47 G48 E78 A81 H82 Y84 K85 R86 Y98 K101 T102
Binding residue
(residue number reindexed from 1)		K20 N21 R22 Y24 Q27 G46 G47 E77 A80 H81 Y83 K84 R85 Y97 K100 T101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0016853 isomerase activity

View graph for
Molecular Function
External links
PDB RCSB:6g1t, PDBe:6g1t, PDBj:6g1t
PDBsum6g1t
PubMed30060171
UniProtQ7BVV5

[Back to BioLiP]