Structure of PDB 6g0y Chain A Binding Site BS01

Receptor Information
>6g0y Chain A (length=161) Species: 11259 (Human respiratory syncytial virus A2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSM
DKSITEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKL
RDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNT
LDIHKSITINN
Ligand information
>6g0y Chain J (length=13) Species: 11259 (Human respiratory syncytial virus A2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PFSKLYKETIETF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6g0y The Structure of the Human Respiratory Syncytial Virus M2-1 Protein Bound to the Interaction Domain of the Phosphoprotein P Defines the Orientation of the Complex.
Resolution2.42 Å
Binding residue
(original residue number in PDB)		R126 T130 Y134 S137 Q144 L148 R151 L152 K159 T160 N163
Binding residue
(residue number reindexed from 1)		R112 T116 Y120 S123 Q130 L134 R137 L138 K145 T146 N149
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0019083 viral transcription
GO:0031564 transcription antitermination
GO:0046782 regulation of viral transcription
GO:0085033 symbiont-mediated activation of host NF-kappaB cascade
Cellular Component
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6g0y, PDBe:6g0y, PDBj:6g0y
PDBsum6g0y
PubMed30425144
UniProtP04545|M21_HRSVA Protein M2-1 (Gene Name=M2-1)

[Back to BioLiP]