Structure of PDB 6fpq Chain A Binding Site BS01

Receptor Information
>6fpq Chain A (length=174) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLNFSRASEHRNEKGERISMINPRVVLDENGISHRSRYFIMLCDNETAIA
HAKKTSIWAVKKDSSKRISDAYKKASVYFIFVAQQTYNALGYAQVVSDLN
STELPFWSDSSHAGGVRIKWIKTCNLFSAEISEIVSHMDHGSEARDGMEM
MYDEGSRLCTLINYAIMKRIGRDR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fpq A low-complexity region in the YTH domain protein Mmi1 enhances RNA binding.
Resolution1.42 Å
Binding residue
(original residue number in PDB)		N336 R338 R349 Y352 Y392 Y406 K436 T437 Y466 S470 C473 N477 R486 D487 R488
Binding residue
(residue number reindexed from 1)		N22 R24 R35 Y38 Y78 Y92 K122 T123 Y152 S156 C159 N163 R172 D173 R174
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6fpq, PDBe:6fpq, PDBj:6fpq
PDBsum6fpq
PubMed29695507
UniProtO74958|MMI1_SCHPO RNA binding exosome specificity factor Mmi1 (Gene Name=mmi1)

[Back to BioLiP]