Structure of PDB 6fl1 Chain A Binding Site BS01

Receptor Information

>6fl1 Chain A (length=271) Species: 1359 (Lactococcus cremoris)

PELPEVETVRRELEKRIVGQKIISIEATYPRMVLTGFEQLKKELTGKTIQ
GISRRGKYLIFEIGDDFRLISHLRMEGKYRLATLDAPREKHDHLTMKFAD
GQLIYADVRKFGTWELISTDQVLPYFLKKKIGPEPTYEDFDEKLFREKLR
KSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKETNQLIESSIHLL
HDSIIEILQKAIKLGGSSIRPYSALGSTGKMQNELQVYGKTGEKCSRCGA
EIQKIKVAGRGTHFCPVCQQK

Ligand information

>6fl1 Chain B (length=14)

ctctttgtttctcg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6fl1 Crystal structure of the complex between the Lactococcus lactis FPG mutant T221P and a Fapy-dG containing DNA
• Resolution: 1.6 Å
• Binding residue (original residue number in PDB): E2 E5 K57 H72 R74 M75 R109 K129 Q163 G170 N171 I172 S217 I219 Y238 K254 K256 R260
• Binding residue (residue number reindexed from 1): E2 E5 K57 H72 R74 M75 R109 K129 Q163 G170 N171 I172 S217 I219 Y238 K254 K256 R260

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Feb 17 01:47:58 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6fl1', asym_id = 'A', bs = 'BS01', title = 'Crystal structure of the complex between the Lac...tis FPG mutant T221P and a Fapy-dG containing DNA'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6fl1', asym_id='A', bs='BS01', title='Crystal structure of the complex between the Lac...tis FPG mutant T221P and a Fapy-dG containing DNA')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003676,0003677,0003684,0003906,0006281,0006284,0008270,0008534,0016799,0019104', uniprot = '', pdbid = '6fl1', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0003684,0003906,0006281,0006284,0008270,0008534,0016799,0019104', uniprot='', pdbid='6fl1', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>