Structure of PDB 6fk4 Chain A Binding Site BS01

Receptor Information
>6fk4 Chain A (length=257) Species: 122586 (Neisseria meningitidis MC58) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMKITTWNVNSLNVRLPQVQNLLADNPPDILVLQELKLDQDKFPAAALQM
MGWHCVWSGQKTYNGVAIVSRSVPQDVHFGLPALPDDPQRRVIAATVSGV
RVINVYCVNGEALDSPKFKYKEQWFAALTEFVRDEMTRHGKLVLLGDFNI
APADADCYDPEKWHEKIHCSSVERQWFQNLLDLGLTDSLRQVHPEGAFYT
WFDYRGAMFQRKLGLRIDHILVSPAMAAALKDVRVDLETRALERPSDHAP
VTAEFDW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fk4 Structural basis for recognition and repair of the 3'-phosphate by NExo, a base excision DNA repair nuclease from Neisseria meningitidis.
Resolution2.297 Å
Binding residue
(original residue number in PDB)		S10 R14 E34 T61 Y62 Y105 N108 K116 N148 Y203 R204 R243 H247
Binding residue
(residue number reindexed from 1)		S11 R15 E35 T62 Y63 Y106 N109 K117 N149 Y204 R205 R244 H248
Enzymatic activity
Catalytic site (original residue number in PDB) N7 E34 D146 N148 D217 D246 H247
Catalytic site (residue number reindexed from 1) N8 E35 D147 N149 D218 D247 H248
Enzyme Commision number 3.1.11.2: exodeoxyribonuclease III.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0008311 double-stranded DNA 3'-5' DNA exonuclease activity
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6fk4, PDBe:6fk4, PDBj:6fk4
PDBsum6fk4
PubMed30329088
UniProtQ9K100

[Back to BioLiP]