Structure of PDB 6fdt Chain A Binding Site BS01

Receptor Information
>6fdt Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHMQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAY
LKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETV
LLLEPGNKQAVTELSKIKKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fdt Deep Structural Analysis of RPAP3 and PIH1D1, Two Components of the HSP90 Co-chaperone R2TP Complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		K286 N290 F293 K294 L317 N321 M324 K351 A354 R355 Q385
Binding residue
(residue number reindexed from 1)		K10 N14 F17 K18 L41 N45 M48 K75 A78 R79 Q109
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6fdt, PDBe:6fdt, PDBj:6fdt
PDBsum6fdt
PubMed30033218
UniProtQ9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 (Gene Name=RPAP3)

[Back to BioLiP]