Structure of PDB 6fdp Chain A Binding Site BS01

Receptor Information
>6fdp Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHMQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAY
LKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETV
LLLEPGNKQAVTELSKIKKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fdp Deep Structural Analysis of RPAP3 and PIH1D1, Two Components of the HSP90 Co-chaperone R2TP Complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		K286 N290 F293 N321 M324 K328 S350 K351 R355 T358 E380 N383 K384 Q385
Binding residue
(residue number reindexed from 1)		K10 N14 F17 N45 M48 K52 S74 K75 R79 T82 E104 N107 K108 Q109
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6fdp, PDBe:6fdp, PDBj:6fdp
PDBsum6fdp
PubMed30033218
UniProtQ9H6T3|RPAP3_HUMAN RNA polymerase II-associated protein 3 (Gene Name=RPAP3)

[Back to BioLiP]