Structure of PDB 6fbx Chain A Binding Site BS01

Receptor Information
>6fbx Chain A (length=148) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLSMSCWLREQTLLLAEDYISFCSGIQQTPPSESAEAMRYLAKEMEQQH
RTKFRSLSQEFLDTCGADPSKCLQSVMRELVGDGKMNWGRVVSIFTFTGV
LASELLSRGENSEGSRRLAETIADYLGGEKQDWLVENGGWEGFCRFFH
Ligand information
>6fbx Chain B (length=22) Species: 7955 (Danio rerio) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LWAAKKYGQQLRRMSDEFDKGQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fbx A structural investigation of NRZ mediated apoptosis regulation in zebrafish.
Resolution1.639 Å
Binding residue
(original residue number in PDB)		M46 H50 K53 F54 L57 E60 E79 L80 D83 G89 R90 S93
Binding residue
(residue number reindexed from 1)		M46 H50 K53 F54 L57 E60 E79 L80 D83 G89 R90 S93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6fbx, PDBe:6fbx, PDBj:6fbx
PDBsum6fbx
PubMed30237469
UniProtQ8UWD5

[Back to BioLiP]