Structure of PDB 6fbk Chain A Binding Site BS01

Receptor Information
>6fbk Chain A (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDTGVRVELAEEDHGRKSTIALRLWVEDPKDNGAIEFTFDLEKETPDEVA
QEMIESGFFHESDVKIVAKSIRDRVALIQWRRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fbk Crystal structure of the human WNK2 CCT-like 1 domain in complex with a WNK1 RFXV peptide
Resolution1.743 Å
Binding residue
(original residue number in PDB)		G494 A495 I496 E497 T499 E505 E513 M514 E516 S517 F519
Binding residue
(residue number reindexed from 1)		G33 A34 I35 E36 T38 E44 E52 M53 E55 S56 F58
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0004674 protein serine/threonine kinase activity
GO:0005524 ATP binding

View graph for
Molecular Function
External links
PDB RCSB:6fbk, PDBe:6fbk, PDBj:6fbk
PDBsum6fbk
PubMed
UniProtQ9Y3S1|WNK2_HUMAN Serine/threonine-protein kinase WNK2 (Gene Name=WNK2)

[Back to BioLiP]