Structure of PDB 6fb8 Chain A Binding Site BS01

Receptor Information
>6fb8 Chain A (length=154) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fb8 Understanding the indirect DNA read-out specificity of I-CreI Meganuclease.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		G19 D20 G21 S22 I24 Q26 K28 N30 T46 Q47 K48 A133 N136 D137 S138 R141 K142
Binding residue
(residue number reindexed from 1)		G18 D19 G20 S21 I23 Q25 K27 N29 T45 Q46 K47 A132 N135 D136 S137 R140 K141
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fb8, PDBe:6fb8, PDBj:6fb8
PDBsum6fb8
PubMed29980759
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]