Structure of PDB 6fad Chain A Binding Site BS01

Receptor Information
>6fad Chain A (length=356) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKK
FVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKIS
GVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLH
TKCRIIHTDIKPENILLSVNEQYIRRLAALVNPLEPKNAEKLKVKIADLG
NACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDY
LFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKH
ITKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLR
HPWLNS
Ligand information
>6fad Chain E (length=12) Species: 10299 (Human alphaherpesvirus 1 strain 17) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RGGRRGRRRGRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fad Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
Resolution2.801 Å
Binding residue
(original residue number in PDB)		Q182 L550 D564 L568 E571 K604 W606 K615 Y616
Binding residue
(residue number reindexed from 1)		Q128 L251 D265 L269 E272 K305 W307 K316 Y317
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003723 RNA binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0006338 chromatin remodeling
GO:0006397 mRNA processing
GO:0006468 protein phosphorylation
GO:0007059 chromosome segregation
GO:0008380 RNA splicing
GO:0016310 phosphorylation
GO:0030154 cell differentiation
GO:0035092 sperm DNA condensation
GO:0035556 intracellular signal transduction
GO:0045070 positive regulation of viral genome replication
GO:0045071 negative regulation of viral genome replication
GO:0045087 innate immune response
GO:0048024 regulation of mRNA splicing, via spliceosome
GO:0050684 regulation of mRNA processing
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016363 nuclear matrix
GO:0016607 nuclear speck

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fad, PDBe:6fad, PDBj:6fad
PDBsum6fad
PubMed31641093
UniProtQ96SB4|SRPK1_HUMAN SRSF protein kinase 1 (Gene Name=SRPK1)

[Back to BioLiP]