Structure of PDB 6f7t Chain A Binding Site BS01

Receptor Information
>6f7t Chain A (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLVLTQSSSASFSLGASAKLTCTLSRQHSTYTIEWYQQQPLKPPKYVMEL
KKDGSHSTGDGIPDRFSGSSSGADRYLSISNIQEEDEAIYICGVGDTIKE
QFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSP
SGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFT
CQVTHEGDTVEKSLSPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f7t Dissociation of the Dimer of the Intrinsically Disordered Domain of RNase Y upon Antibody Binding.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y31 T32 E34 G91 T93 F95C Y96
Binding residue
(residue number reindexed from 1)		Y31 T32 E34 G95 T97 F102 Y104
External links