Structure of PDB 6f58 Chain A Binding Site BS01

Receptor Information
>6f58 Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYS
FLLDFVAADNHRWKYVNGEWVPGAPSCVYIHPDSPNFGAHWMKAPVSFSK
VKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFPETQFIAV
TAYQNEEITALKIKYNPFAKAFLDAKERSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f58 Crystal structure of human Brachyury (T) in complex with DNA
Resolution2.253 Å
Binding residue
(original residue number in PDB)
K66 N150 S162 T196 P212 F213 A216
Binding residue
(residue number reindexed from 1)
K27 N105 S117 T151 P167 F168 A171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6f58, PDBe:6f58, PDBj:6f58
PDBsum6f58
PubMed
UniProtO15178|TBXT_HUMAN T-box transcription factor T (Gene Name=TBXT)

[Back to BioLiP]