Structure of PDB 6f55 Chain A Binding Site BS01

Receptor Information
>6f55 Chain A (length=67) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVPGVRVRALYDYTGQEADELSFKAGEELMKISEEDEQGWCKGRLLTGH
VGLYPANYVEKVGLAAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f55 Structural Basis of TRPV4 N Terminus Interaction with Syndapin/PACSIN1-3 and PIP2.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y12 Q17 D37 Q39 W41 N57 Y58
Binding residue
(residue number reindexed from 1)		Y12 Q17 D37 Q39 W41 N57 Y58
Enzymatic activity
Enzyme Commision number ?
External links