Structure of PDB 6f0h Chain A Binding Site BS01

Receptor Information
>6f0h Chain A (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESE
EYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTY
RGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHI
NW
Ligand information
>6f0h Chain B (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ASTEEKWARLARRIAGAGGVTLDGFG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f0h Design on a Rational Basis of High-Affinity Peptides Inhibiting the Histone Chaperone ASF1.
Resolution1.98 Å
Binding residue
(original residue number in PDB)
N7 N8 V9 V45 A48 E49 D54 V94 L96 R108 Y112 P144 R145 V146 T147 R148 F149
Binding residue
(residue number reindexed from 1)
N6 N7 V8 V44 A47 E48 D53 V93 L95 R107 Y111 P143 R144 V145 T146 R147 F148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6f0h, PDBe:6f0h, PDBj:6f0h
PDBsum6f0h
PubMed31543461
UniProtQ9Y294|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]