Structure of PDB 6ezi Chain A Binding Site BS01

Receptor Information
>6ezi Chain A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMHKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDED
VIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ezi Probing the Architecture of a Multi-PDZ Domain Protein: Structure of PDZK1 in Solution.
Resolution1.50332 Å
Binding residue
(original residue number in PDB)
G387 Y388 F390 H391 L392 N393 A394 I395 R396 Y436
Binding residue
(residue number reindexed from 1)
G16 Y17 F19 H20 L21 N22 A23 I24 R25 Y65
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ezi, PDBe:6ezi, PDBj:6ezi
PDBsum6ezi
PubMed30220543
UniProtQ5T2W1|NHRF3_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (Gene Name=PDZK1)

[Back to BioLiP]