Structure of PDB 6exj Chain A Binding Site BS01

Receptor Information
>6exj Chain A (length=89) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVAILQKRDHEGFGFVLRGAKAEPTPAFPALQYLESVDVEGVAWKAGLRT
GDFLIEVNGVNVVKVGHKQVVGLIRQGGNRLVMKVVSVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6exj Structural basis for PDZ domain interactions in the post-synaptic density scaffolding protein Shank3.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		G655 F656 G657 F658 V659 L660 R661 G662 A663 K664 H717
Binding residue
(residue number reindexed from 1)		G12 F13 G14 F15 V16 L17 R18 G19 A20 K21 H67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6exj, PDBe:6exj, PDBj:6exj
PDBsum6exj
PubMed29473168
UniProtQ9JLU4|SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 (Gene Name=Shank3)

[Back to BioLiP]