Structure of PDB 6eol Chain A Binding Site BS01

Receptor Information

>6eol Chain A (length=138) Species: 9606 (Homo sapiens)

MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPR
FNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVA
VNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Ligand information

• Ligand ID: BKH
• InChI: InChI=1S/C20H16Cl2F3N3O4S/c21-10-2-1-9(5-11(10)22)33-20-19(31)17(18(30)15(7-29)32-20)28-6-14(26-27-28)8-3-12(23)16(25)13(24)4-8/h1-6,15,17-20,29-31H,7H2/t15-,17+,18+,19-,20-/m1/s1
• InChIKey: CSGJIUAIYDKFPC-DABHTEOTSA-N
• SMILES:
  OpenEye OEToolkits 2.0.6: c1cc(c(cc1SC2C(C(C(C(O2)CO)O)n3cc(nn3)c4cc(c(c(c4)F)F)F)O)Cl)Cl
  OpenEye OEToolkits 2.0.6: c1cc(c(cc1S[C@@H]2[C@@H]([C@H]([C@H]([C@H](O2)CO)O)n3cc(nn3)c4cc(c(c(c4)F)F)F)O)Cl)Cl
  CACTVS 3.385: OC[CH]1O[CH](Sc2ccc(Cl)c(Cl)c2)[CH](O)[CH]([CH]1O)n3cc(nn3)c4cc(F)c(F)c(F)c4
  CACTVS 3.385: OC[C@H]1O[C@H](Sc2ccc(Cl)c(Cl)c2)[C@H](O)[C@H]([C@H]1O)n3cc(nn3)c4cc(F)c(F)c(F)c4
• Formula: C20 H16 Cl2 F3 N3 O4 S
• Name: (2~{R},3~{R},4~{S},5~{R},6~{R})-2-(3,4-dichlorophenyl)sulfanyl-6-(hydroxymethyl)-4-[4-[3,4,5-tris(fluoranyl)phenyl]-1,2,3-triazol-1-yl]oxane-3,5-diol
• ChEMBL: CHEMBL5181579
• PDB chain: 6eol Chain A Residue 303

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6eol Monosaccharide Derivatives with Low-Nanomolar Lectin Affinity and High Selectivity Based on Combined Fluorine-Amide, Phenyl-Arginine, Sulfur-pi , and Halogen Bond Interactions.
• Resolution: 1.5 Å
• Binding residue (original residue number in PDB): R144 I145 A146 H158 N160 R162 N174 W181 E184 S237 G238
• Binding residue (residue number reindexed from 1): R32 I33 A34 H46 N48 R50 N62 W69 E72 S125 G126
• Annotation score: 1
• Binding affinity: MOAD: Kd=0.037uM
  PDBbind-CN: -logKd/Ki=7.43,Kd=0.037uM

Gene Ontology

Molecular Function

• GO:0030246 carbohydrate binding

External links

• PDB: RCSB:6eol, PDBe:6eol, PDBj:6eol
• PDBsum: 6eol
• PubMed: 29194992
• UniProt: P17931|LEG3_HUMAN Galectin-3 (Gene Name=LGALS3)