Structure of PDB 6en0 Chain A Binding Site BS01

Receptor Information

>6en0 Chain A (length=307) Species: 1351 (Enterococcus faecalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SMTVCQLYAKQIRHRGNVKHNTKLGRERLMRILEQDRLGSCPIDSVKLSD
AKEWALRMKEKGLSYKTINNDKRSLKAAFYTAIQDDCIRKNPFDFQLSDV
LDDDTEPKVPLTPAQEESFLSFIQGDKVYQKHYDAIVILLGTGLRISELC
GLTDKDLDFENRVIIVSHQLLRNTGVGYYIDVRKIPMNEEVYQAFQRVIK
NRKGAKPFIIDGYANFLFLKQNGYPMTAVDYGGMFGRLVKKYNKSHEEAL
PKTTTPHAMRHTFCTRLANAGMNPKALQYIMGHSNITMTLNYYAHATFDS
ARAEMER

Ligand information

>6en0 Chain C (length=36) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ataacctaaaattttatagcaaaattatatgggatt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6en0 Transposase-DNA Complex Structures Reveal Mechanisms for Conjugative Transposition of Antibiotic Resistance.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	R108 R111 L143 S144 T147 N150 K188 T254 H344 R347 S371
Binding residue (residue number reindexed from 1)	R28 R31 L63 S64 T67 N70 K108 T174 H257 R260 S284

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6en0, PDBe:6en0, PDBj:6en0
PDBsum	6en0
PubMed	29551265
UniProt	Q7BP35

[Back to BioLiP]