Structure of PDB 6ecd Chain A Binding Site BS01

Receptor Information

>6ecd Chain A (length=245) Species: 285482 (Streptomyces tsusimaensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DPTAKLVRLNPGDGPGIVFAPPAGGTVLGYIELARHLKGFGEIHGVEAPG
LGETPVYPSFEEMVQFCSDSAAGVAGDGVYIGGHSLGGHIAFYLATMLLD
RGIRPKGLIILDTPPRLKVFILAMGIGGMLDQEEAKQLLLDRAKNDPRVS
AFLSEDYLDRFLRLQMHQLMYSRDVVLPQRKLDIPIHVFRTKNHAPEVAR
LFSAWENYAAGEVTFVDIPGDHATMLRAPHVSEVAQLLDRHCGLP

Ligand information

>6ecd Chain B (length=2) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6ecd Trapping biosynthetic acyl-enzyme intermediates with encoded 2,3-diaminopropionic acid.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	X2463 L2464
Binding residue (residue number reindexed from 1)	X85 L86

Enzymatic activity

Enzyme Commision number

3.1.2.-

Gene Ontology

	Biological Process
GO:0009058	biosynthetic process

View graph for
Biological Process

External links

PDB	RCSB:6ecd, PDBe:6ecd, PDBj:6ecd
PDBsum	6ecd
PubMed	30542153
UniProt	Q1PSF3

[Back to BioLiP]