Structure of PDB 6e93 Chain A Binding Site BS01

Receptor Information
>6e93 Chain A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PYACELCAKQFQSPSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHER
IHLGLKEFVCQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQRFLYLST
KRNHEQRHIREH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e93 Structural insights into methylated DNA recognition by the C-terminal zinc fingers of the DNA reader protein ZBTB38.
Resolution1.747 Å
Binding residue
(original residue number in PDB)		H1028 C1031 R1045 F1047 N1052 H1056 I1059 K1073 H1084 Y1105 T1108 N1111 R1115
Binding residue
(residue number reindexed from 1)		H20 C23 R37 F39 N44 H48 I51 K65 H76 Y97 T100 N103 R107
Binding affinityPDBbind-CN: Kd=5nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6e93, PDBe:6e93, PDBj:6e93
PDBsum6e93
PubMed30355731
UniProtQ8NAP3|ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 (Gene Name=ZBTB38)

[Back to BioLiP]