Structure of PDB 6e8r Chain A Binding Site BS01

Receptor Information
>6e8r Chain A (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDA
YVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQEL
EAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQ
Ligand information
>6e8r Chain C (length=20) Species: 813 (Chlamydia trachomatis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPAVQFFKGKNGSADQVILV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e8r Crystal structure of the SNX32 PX domain in complex with the Chlamydia trachomatis inclusion protein IncE
Resolution2.268 Å
Binding residue
(original residue number in PDB)		E29 I30 S31 D32 A33 V34 S35 L101 E124 Y127 L128 F131 K132
Binding residue
(residue number reindexed from 1)		E6 I7 S8 D9 A10 V11 S12 L78 E101 Y104 L105 F108 K109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0035091 phosphatidylinositol binding

View graph for
Molecular Function
External links
PDB RCSB:6e8r, PDBe:6e8r, PDBj:6e8r
PDBsum6e8r
PubMed
UniProtQ86XE0|SNX32_HUMAN Sorting nexin-32 (Gene Name=SNX32)

[Back to BioLiP]