Structure of PDB 6e8k Chain A Binding Site BS01

Receptor Information
>6e8k Chain A (length=157) Species: 661367 (Legionella longbeachae NSW150) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKIPIIFGLINSYQIHNLLEQHNAKTKESKAVFLIRDSSTYPGLLTISYY
CQEQDIVKHIRFGLTDKGWKTAPKPPHEPLKSDSPEIKEKYTLDKIKFER
KMKQFINTAKKLFEQHIRAESFKTLIMELKIHEFNLEGLIKPTRSQASQE
KHFTDYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e8k Identification and characterization of a large family of superbinding bacterial SH2 domains.
Resolution1.71 Å
Binding residue
(original residue number in PDB)
R46 S48 S49 T50 T56 H69 R71 P85 H87
Binding residue
(residue number reindexed from 1)
R36 S38 S39 T40 T46 H59 R61 P75 H77
Enzymatic activity
Enzyme Commision number ?
External links