Structure of PDB 6e8c Chain A Binding Site BS01

Receptor Information
>6e8c Chain A (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGRGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQI
WFQNERSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEK
DRFPGIAAREELARETGLPESRIQIWFQNRRARHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e8c Crystal Structure of the Double Homeodomain of DUX4 in Complex with DNA.
Resolution2.12 Å
Binding residue
(original residue number in PDB)		R16 R20 R21 R23 L24 W26 R62 I65 N69 R73 R98 F118 R124 Q139 Q143 R146
Binding residue
(residue number reindexed from 1)		R1 R5 R6 R8 L9 W11 R47 I50 N54 R58 R83 F103 R109 Q124 Q128 R131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6e8c, PDBe:6e8c, PDBj:6e8c
PDBsum6e8c
PubMed30540931
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]