Structure of PDB 6e49 Chain A Binding Site BS01

Receptor Information
>6e49 Chain A (length=255) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSL
EIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSII
LLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRD
LSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMD
QPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFL
APKFN
Ligand information
>6e49 Chain E (length=8) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIAAMLQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e49 Role of the Pif1-PCNA Complex in Pol delta-Dependent Strand Displacement DNA Synthesis and Break-Induced Replication.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R44 V45 F249 A251
Binding residue
(residue number reindexed from 1)		R44 V45 F249 A251
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
GO:0042802 identical protein binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0000710 meiotic mismatch repair
GO:0006260 DNA replication
GO:0006272 leading strand elongation
GO:0006273 lagging strand elongation
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006298 mismatch repair
GO:0006301 postreplication repair
GO:0007064 mitotic sister chromatid cohesion
GO:0019985 translesion synthesis
GO:0030466 silent mating-type cassette heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0034087 establishment of mitotic sister chromatid cohesion
GO:0035753 maintenance of DNA trinucleotide repeats
GO:0045739 positive regulation of DNA repair
GO:0045740 positive regulation of DNA replication
GO:0051054 positive regulation of DNA metabolic process
GO:0070987 error-free translesion synthesis
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005657 replication fork
GO:0043626 PCNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6e49, PDBe:6e49, PDBj:6e49
PDBsum6e49
PubMed29141206
UniProtP15873|PCNA_YEAST Proliferating cell nuclear antigen (Gene Name=POL30)

[Back to BioLiP]