Structure of PDB 6e3i Chain A Binding Site BS01

Receptor Information
>6e3i Chain A (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVE
KNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGIL
IKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFE
PK
Ligand information
>6e3i Chain B (length=21) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QRVVHIAAGLRRTGDQLEAYG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6e3i Peptide design by optimization on a data-parameterized protein interaction landscape.
Resolution1.481 Å
Binding residue
(original residue number in PDB)
C55 Q73 V74 K77 E78 D81 N85 W86 G87 R88 T91 F95 K147
Binding residue
(residue number reindexed from 1)
C56 Q74 V75 K78 E79 D82 N86 W87 G88 R89 T92 F96 K148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6e3i, PDBe:6e3i, PDBj:6e3i
PDBsum6e3i
PubMed30322927
UniProtQ16548|B2LA1_HUMAN Bcl-2-related protein A1 (Gene Name=BCL2A1)

[Back to BioLiP]