Structure of PDB 6dta Chain A Binding Site BS01

Receptor Information
>6dta Chain A (length=250) Species: 10752 (Enquatrovirus N4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STIEHQMHLEKLYNKNQLLPRMRQEFEENSGIDFKAFFAHIGIDYKFGID
AMVQMALHKRADLPTLVGTLRHHCKSAQEVADNLFKMASEDCFNFDPTID
KFIVIYTISDDVQHELDSFQYPLPMVVRPKLLTKNYGTGYFTCNKSVILK
KNHTDDDICLDHLNRMNKIPLSINWDVAHMVKNEWANLFQKYDRTAHEVM
GLLTQEGNKFYLTHRPDKRGRTYSQGYHVNYQGTSWNKAVLEFAEKEVID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dta Minimalism and functionality: Structural lessons from the heterodimeric N4 bacteriophage RNA polymerase II.
Resolution2.694 Å
Binding residue
(original residue number in PDB)		L58 H59 K60 R61 Y122 K151 K237 R238 Y242 Y246
Binding residue
(residue number reindexed from 1)		L57 H58 K59 R60 Y121 K150 K218 R219 Y223 Y227
Enzymatic activity
Enzyme Commision number ?
External links