Structure of PDB 6dnw Chain A Binding Site BS01

Receptor Information
>6dnw Chain A (length=231) Species: 272626 (Listeria innocua Clip11262) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDI
FEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKG
IHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVH
RRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVN
NYLEFREKQLYLKSLINKIYIDGEQVTIEWL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dnw Serine Integrase attP Binding and Specificity.
Resolution2.849 Å
Binding residue
(original residue number in PDB)		G139 K142 R143 T152 A153 R156 T165 S189 T191 Y207 N208 M254 N261 K262 K286 S290 K293 Y295 Y297 Y299 T308 K313 I318 R320
Binding residue
(residue number reindexed from 1)		G6 K9 R10 T19 A20 R23 T32 S56 T58 Y74 N75 M121 N128 K129 K153 S157 K160 Y162 Y164 Y166 T175 K180 I185 R187
Binding affinityPDBbind-CN: Kd=49nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding

View graph for
Molecular Function
External links
PDB RCSB:6dnw, PDBe:6dnw, PDBj:6dnw
PDBsum6dnw
PubMed30227134
UniProtQ928V6

[Back to BioLiP]