Structure of PDB 6dn8 Chain A Binding Site BS01

Receptor Information
>6dn8 Chain A (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQ
STDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTAL
VGSDAESWGWDLGRSRLYHDGKNQPGVAYPAFLFALPDSLLVVLDMDEGT
LSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dn8 A Cyclic Peptide Inhibitor of the iNOS-SPSB Protein-Protein Interaction as a Potential Anti-Infective Agent.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
R77 P79 V80 A81 G110 T111 Y129 V216 W217 G218
Binding residue
(residue number reindexed from 1)
R45 P47 V48 A49 G78 T79 Y97 V179 W180 G181
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6dn8, PDBe:6dn8, PDBj:6dn8
PDBsum6dn8
PubMed30226743
UniProtQ96A44|SPSB4_HUMAN SPRY domain-containing SOCS box protein 4 (Gene Name=SPSB4)

[Back to BioLiP]