Structure of PDB 6dn5 Chain A Binding Site BS01

Receptor Information
>6dn5 Chain A (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQST
DGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLG
SNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEE
GTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dn5 A Cyclic Peptide Inhibitor of the iNOS-SPSB Protein-Protein Interaction as a Potential Anti-Infective Agent.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
R68 P70 V71 G101 T102 Y120 V206 W207 G208
Binding residue
(residue number reindexed from 1)
R43 P45 V46 G76 T77 Y95 V181 W182 G183
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6dn5, PDBe:6dn5, PDBj:6dn5
PDBsum6dn5
PubMed30226743
UniProtQ99619|SPSB2_HUMAN SPRY domain-containing SOCS box protein 2 (Gene Name=SPSB2)

[Back to BioLiP]