Structure of PDB 6dm6 Chain A Binding Site BS01

Receptor Information

>6dm6 Chain A (length=378) Species: 272944 (Rickettsia conorii str. Malish 7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HHMLKLIVETKTLVQSLGFASSVVEKRPEYANIKLSAKDGNLELSSTNMD
LYLSQKIAVQVVSEGECTVSTKTLNDIVRKLPDSELTLTDLGTTGLEIKG
KNCKFNLFTLPVSSFPAMDSINPEASFKISCTDFAKIIESTKFSISLDET
RYNLNGVYLHIKDKEFCSASTDGHRLSISWVTLEKQIKNFGVILPQKSAE
EILKIVKDPKNINEDIEILLSSNKIKFICNENTSMLSKLIDGTFPDYSTF
IPESSSSKLVINRKMFADSIERIAIITVEKFRAVKLSLSRETLEISAVGE
ARGNAKEVINSSQDKESFYEYNSDESLAIGFNPQYLEDVLKAVKSDVVEL
YFSDVSAPVLIKFPENPKDIFVVMPVKV

Ligand information

>6dm6 Chain C (length=10) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VKTLKLVPLG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6dm6 Structure of DNA polymerase III subunit beta from Rickettsia conorii in complex with a natural product
Resolution	2.25 Å
Binding residue (original residue number in PDB)	G174 H175 R176 F251 M375 P376 V377 K378
Binding residue (residue number reindexed from 1)	G173 H174 R175 F250 M374 P375 V376 K377

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003887	DNA-directed DNA polymerase activity
GO:0008408	3'-5' exonuclease activity

	Biological Process
GO:0006260	DNA replication
GO:0006271	DNA strand elongation involved in DNA replication
GO:0071897	DNA biosynthetic process

	Cellular Component
GO:0005737	cytoplasm
GO:0009360	DNA polymerase III complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6dm6, PDBe:6dm6, PDBj:6dm6
PDBsum	6dm6
PubMed
UniProt	Q92I37\|DPO3B_RICCN Beta sliding clamp (Gene Name=dnaN)

[Back to BioLiP]