Structure of PDB 6dig Chain A Binding Site BS01

Receptor Information
>6dig Chain A (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEF
SKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVT
LGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKI
SYLTFLPSADEIYDCKVEHWGLDQPLLKHWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6dig In vivo clonal expansion and phenotypes of hypocretin-specific CD4+T cells in narcolepsy patients and controls.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		C11 N14 H27 Q34 G55 G56 F57 N65 V68 N72 I75 M76 R79
Binding residue
(residue number reindexed from 1)		C10 N13 H26 Q33 G54 G55 F56 N64 V67 N71 I74 M75 R78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dig, PDBe:6dig, PDBj:6dig
PDBsum6dig
PubMed31748512
UniProtQ30066

[Back to BioLiP]