Structure of PDB 6dg0 Chain A Binding Site BS01

Receptor Information

>6dg0 Chain A (length=84) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AASTLFVANLSAEVNEDTLRGVFKAFSGFTRLRLHNKNGSAVAFVEYSDL
QKATQAMISLQGFQTANDRGGLRIEYARNKMADV

Ligand information

>6dg0 Chain D (length=6) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agcaca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6dg0 Structure of MEC-8 RRM2 in complex with AGCACA
Resolution	2.457 Å
Binding residue (original residue number in PDB)	F24 A26 R51 H53 F62 R92 E94 R97 M100 A101
Binding residue (residue number reindexed from 1)	F6 A8 R33 H35 F44 R73 E75 R78 M81 A82

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:6dg0, PDBe:6dg0, PDBj:6dg0
PDBsum	6dg0
PubMed
UniProt	G5ECJ4

[Back to BioLiP]